Overview
Tamapin (#STT-400) is a highly pure, synthetic, and biologically active peptide toxin.
Alternative Name K+ channel toxin α-KTx 5.4
Structure
For research purposes only, not for human use
Applications
Citations (50)
Citations
Powered by BiozProduct citations
- Chubanov, V. et al. (2012) Br. J. Pharmacol. 166, 1357.
Specifications
Properties
Technical Specifications
Origin Synthetic peptide
MW 3458.16 Da
Sequence AFCNLRRCELSCRSLGLLGKCIGEECKCVPY.
Modifications Disulfide bonds between Cys3-Cys21, Cys8-Cys26, and Cys12-Cys28. Tyr31 - C terminal amidation.
Peptide Content 100%
Purity >98% (HPLC)
Molecular formula C146H238N44O41S6
Accession number
Biological Activity
Target KCa2 K+ channels
Effective concentration 500 pM - 50 nM.
Activity Tamapin blocks KCa2 channels. Tamapin displays a remarkable selectivity for KCa2.2 versus KCa2.1 channels1.
References
- Pedarzani, P. et al. (2002) J. Biol. Chem. 277, 46101.
Solubility and Storage
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage of solutions Up to four weeks at 4°C or three months at -20°C.
Scientific Background
References
Scientific background Tamapin is a 31 amino acid peptidyl toxin, isolated from the venom of the Indian red scorpion, Mesobuthus tamulus, and is classified as α-5.4 scorpion toxin family1 with three disulfide bridges. Native Tamapin blocks KCa2 channels in pyramidal neurons of the hippocampus as well as in cell lines expressing distinct KCa2 channel subunits. Tamapin displays a remarkable selectivity for KCa2.2 (SK2/KCNN2, IC50 = 24 pM) versus KCa2.1 (SK1/KCNN1, approx 1750 fold) and KCa2.3 (SK3/KCNN3) channels2.
References
- Rodriguez de la Vega, R.C. and Possani, L.D. (2004) Toxicon 43, 865.
- Pedarzani, P. et al. (2002) J. Biol. Chem. 277, 46101.
Last Update: 08/01/2025
