Overview
Lq2 (#RTL-550) is a highly pure, recombinant, and biologically active peptide toxin.
Alternative Name K+ channel toxin α-KTx 1.2, Charybdotoxin-2, ChTX-Lq2, ChTx-d, Toxin 18-2, Lqh 18-2
Structure
For research purposes only, not for human use
Applications
Citations (2)
Citations
Powered by BiozProduct citations
- Meneses, D. et al. (2015) Synapse. 69, 446.
Specifications
Properties
Technical Specifications
Origin Recombinant, E. coli
MW 4353 Da
Sequence QFTQESCTASNQCWSICKRLHNTNRGKCMNKKCRCYS.
Modifications Disulfide bonds between Cys7-Cys28, Cys13-Cys33 and Cys17-Cys35.
Peptide Content 100%
Purity >98% (HPLC)
Molecular formula C177H280N60O55S7.
Accession number
Biological Activity
Target Kir1.1 K+ channels
Effective concentration 0.1-10 nM.
Activity Lq2 inhibits Kir1.1 K+ inward rectifier channels2, as well as KCa channels1.
References
- Lucchesi, K. et al. (1989) J. Membr. Biol. 109, 269.
- Lu, Z. and MacKinnon, R. (1997) Biochemistry 36, 6936.
Solubility and Storage
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Scientific Background
Scientific Background
Scientific background
Lq2 was originally isolated from Leiurus quinquestriatus hebraeus scorpion venom.1
Lq2 blocks Kir1.1 K+ inward rectifier channels (Ki of 410 nM).2
In the planar lipid bilayer, it also blocked single KCa channels from rat muscle with intrinsic KD of 43 nM,1 by introducing brief closures. Lq2 action is on the extracellular side of the pore.
References
- Lucchesi, K. et al. (1989) J. Membr. Biol. 109, 269.
- Lu, Z. and MacKinnon, R. (1997) Biochemistry 36, 6936.
Last Update: 08/01/2025
